PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Vang06g12210.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
Family MYB_related
Protein Properties Length: 214aa    MW: 24215.8 Da    PI: 4.4093
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Vang06g12210.1genomeSNUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding54.13.7e-171862147
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                     rg++T eE+e +++++++lG++ W++Ia++++ gRt++++k+ w++ 
   Vang06g12210.1 18 RGNFTSEEEETIIKLHEMLGNR-WSAIAAKLP-GRTDNEIKNVWHTN 62
                     89********************.*********.***********986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129423.8871367IPR017930Myb domain
SuperFamilySSF466893.14E-141370IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.603.4E-231367IPR009057Homeodomain-like
SMARTSM007171.5E-141765IPR001005SANT/Myb domain
PfamPF002491.7E-151862IPR001005SANT/Myb domain
CDDcd001671.78E-112063No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 214 aa     Download sequence    Send to blast
MAMAIGVPSQ NKQPDIKRGN FTSEEEETII KLHEMLGNRW SAIAAKLPGR TDNEIKNVWH  60
TNLKKRLLNS NSRRVTKPKI KRSDSNSSII TESEAANFNF REMDSTSACT TSSDFSSVTV  120
GESKNIKCED IESLETMPVI DESFWSEPAI DEAPSMSSQS MTISNQMPFQ YPFTNYEETF  180
PQSHAYDSNF DDGMDFWYDI FTRTADSTEL PEF*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A3e-12146755108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150410.0AP015041.1 Vigna angularis var. angularis DNA, chromosome 8, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014510965.11e-140PREDICTED: myb-related protein Myb4-like
TrEMBLA0A0L9TZH81e-146A0A0L9TZH8_PHAAN; Uncharacterized protein
TrEMBLA0A0S3SPS11e-146A0A0S3SPS1_PHAAN; Uncharacterized protein
STRINGGLYMA20G35180.11e-114(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF3134817
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G23250.28e-41myb domain protein 15